Anti-FAM173B

family with sequence similarity 173, member B, Polyclonal, IgG, Rabbit

Sequence: TPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGY

GeneName: FAM173B

Ensembl Gene ID: ENSG00000150756

UniProt ID: Q6P4H8

Entrez Gene ID: 134145

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000039065: 87%, ENSRNOG00000022347: 84%

Enhanced Validation: No

• SKU: ATLHPA074513-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074513-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 134145
• Host: Rabbit
• Conjugate: Unconjugated