Anti-FCAMR

Fc receptor, IgA, IgM, high affinity, Polyclonal, IgG, Rabbit

GeneName: FCAMR

Concentration: 0,05

Sequence: SAEGRRTPGATRPAAPGTGSWAEGSVKAPAPIPESPPSKSRSMSNTTEGVWEGTRSSVTNRARASKDRREMTTTKADRPREEIE

InterspeciesReactivity: ENSMUSG00000026415: 52%, ENSRNOG00000004393: 47%

Entrez Gene ID: 83953

Uniprot ID: Q8WWV6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal FCAMR Antibody against Human Fc alpha and mu receptor. Validated for Western Blot

• SKU: ATLHPA054043-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA054043-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 83953
• Host: Rabbit
• Conjugate: Unconjugated