Anti-KIRREL2

kin of IRRE like 2 (Drosophila), Polyclonal, IgG, Rabbit

GeneName: KIRREL2

Concentration: 0,2

Sequence: PTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTH

InterspeciesReactivity: ENSMUSG00000036915: 82%, ENSRNOG00000020864: 82%

Entrez Gene ID: 84063

Uniprot ID: Q6UWL6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal KIRREL2 Antibody against Human kirre like nephrin family adhesion molecule 2. Validated for Western Blot

• SKU: ATLHPA056206-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA056206-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 84063
• Host: Rabbit
• Conjugate: Unconjugated