Anti-MCTP2

multiple C2 and transmembrane domain containing 2, Polyclonal, IgG, Rabbit

GeneName: MCTP2

Concentration: 0,05

Sequence: RHRWSNRKRLSASKSSLIRNLRLSESLKKNQLWNGIISITLLEGKNVSGGSMTEMFVQLKLGDQRYKSKTLCKSANPQW

InterspeciesReactivity: ENSMUSG00000032776: 96%, ENSRNOG00000009932: 94%

Entrez Gene ID: 55784

Uniprot ID: Q6DN12

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal MCTP2 Antibody against Human multiple C2 and transmembrane domain containing 2. Validated for Western Blot

• SKU: ATLHPA054752-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA054752-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 55784
• Host: Rabbit
• Conjugate: Unconjugated