Anti-MTOR

mechanistic target of rapamycin (serine/threonine kinase), Polyclonal, IgG, Rabbit

Sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE

GeneName: MTOR

Ensembl Gene ID: ENSG00000198793

UniProt ID: P42345

Entrez Gene ID: 2475

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.05

Interspecies Mouse/Rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%

Enhanced Validation: No

• SKU: ATLHPA071227-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA071227-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 2475
• Host: Rabbit
• Conjugate: Unconjugated