Anti-OPG (AbAb01OPG)

Anti-OPG [AbAb01OPG], Recombinant, IgG1 kappa, Mouse
SKU
ABAAb04113-1.1
Packaging Unit
100 μg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: AbAb01OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Buffer Composition: PBS with 0.02% Proclin 300.

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Uniprot Accession No.: O00300

Specificity Statement: This antibody is specific for the N-terminal epitope of OPG.

Application Notes (Clone): This antibody was generated as a capture antibody that binds to the N-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding detection antibody (AbAb02OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
More Information
SKU ABAAb04113-1.1
Manufacturer Absolute Antibody
Manufacturer SKU Ab04113-1.1
Package Unit 100 μg
Quantity Unit STK
Reactivity Human
Clonality Recombinant
Application ELISA
Isotype IgG1 kappa
Host Mouse
Product information (PDF) Download
MSDS (PDF) Download