Anti-PHLPP1

PH domain and leucine rich repeat protein phosphatase 1, Polyclonal, IgG, Rabbit

GeneName: PHLPP1

Concentration: 0,5

Sequence: HCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGG

InterspeciesReactivity: ENSMUSG00000044340: 94%, ENSRNOG00000002821: 93%

Entrez Gene ID: 23239

Uniprot ID: O60346

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal PHLPP1 Antibody against Human PH domain and leucine rich repeat protein phosphatase 1. Validated for Western Blot

• SKU: ATLHPA076883-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076883-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 23239
• Host: Rabbit
• Conjugate: Unconjugated