Anti-Phospholipase A2 (AbAb01-PLA2)

Anti-Phospholipase A2 [AbAb01-PLA2], Recombinant
SKU
ABAAb04530-1.159
Packaging Unit
100 μg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: AbAb01-PLA2

Antigen Long Description: A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generated this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.

Buffer Composition: PBS with 0.02% Proclin 300.

Chimeric Use Statement: This is a chimeric antibody, developed from the original camelid VHH antibody, specifically engineered for enhanced compatibility with existing reagents, assays, and techniques.

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Specificity Statement: This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).

Application Notes (Clone): This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.
More Information
SKU ABAAb04530-1.159
Manufacturer Absolute Antibody
Manufacturer SKU Ab04530-1.159
Package Unit 100 μg
Quantity Unit STK
Reactivity Various species
Clonality Recombinant
Application ELISA
Product information (PDF)
×
MSDS (PDF) Download