CloneID: AbAb02-PLA2
Heavy Chain modification: His-tagged
Antigen Long Description: A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.
Buffer Composition: PBS with 0.02% Proclin 300.
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Specificity Statement: This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).
Application Notes (Clone): This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.