Anti-PIAS2

protein inhibitor of activated STAT 2, Polyclonal, IgG, Rabbit

Sequence: MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI

GeneName: PIAS2

Ensembl Gene ID: ENSG00000078043

UniProt ID: O75928

Entrez Gene ID: 9063

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSMUSG00000025423: 89%, ENSRNOG00000017493: 89%

Enhanced Validation: No

• SKU: ATLHPA077584-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077584-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 9063
• Host: Rabbit
• Conjugate: Unconjugated