Anti-PIPOX

pipecolic acid oxidase, Polyclonal, IgG, Rabbit

GeneName: PIPOX

Concentration: 0,1

Sequence: MVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPV

InterspeciesReactivity: ENSMUSG00000017453: 78%, ENSRNOG00000008798: 77%

Entrez Gene ID: 51268

Uniprot ID: Q9P0Z9

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal PIPOX Antibody against Human pipecolic acid and sarcosine oxidase. Validated for Western Blot

• SKU: ATLHPA015920-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA015920-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 51268
• Host: Rabbit
• Conjugate: Unconjugated