Anti-RTRAF

chromosome 14 open reading frame 166, Polyclonal, IgG, Rabbit

GeneName: C14orf166

Concentration: 0,05

Sequence: AGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVG

InterspeciesReactivity: ENSMUSG00000021807: 99%, ENSRNOG00000000340: 99%

Entrez Gene ID: 51637

Uniprot ID: Q9Y224

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal RTRAF Antibody against Human RNA transcription, translation and transport factor. Validated for Western Blot

• SKU: ATLHPA054777-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA054777-100
• Package Unit: 100UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 51637
• Host: Rabbit
• Conjugate: Unconjugated