Anti-TOMM20L

translocase of outer mitochondrial membrane 20 like, Polyclonal, IgG, Rabbit

Sequence: AFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFLQEVRMGELWLSRGEH

GeneName: TOMM20L

Ensembl Gene ID: ENSG00000196860

UniProt ID: Q6UXN7

Entrez Gene ID: 387990

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.3

Interspecies Mouse/Rat: ENSRNOG00000054663: 60%, ENSMUSG00000021078: 58%

Enhanced Validation: Yes

• SKU: ATLHPA076397-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA076397-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 387990
• Host: Rabbit
• Conjugate: Unconjugated