Anti-VPS33B

vacuolar protein sorting 33 homolog B (yeast), Polyclonal, IgG, Rabbit

GeneName: VPS33B

Concentration: 0,1

Sequence: KLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKED

InterspeciesReactivity: ENSMUSG00000030534: 96%, ENSRNOG00000013149: 98%

Entrez Gene ID: 26276

Uniprot ID: Q9H267

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal VPS33B Antibody against Human VPS33B late endosome and lysosome associated. Validated for Western Blot

• SKU: ATLHPA059834-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA059834-25
• Package Unit: 25UL
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 26276
• Host: Rabbit
• Conjugate: Unconjugated