Anti-ZBTB8B

zinc finger and BTB domain containing 8B, Polyclonal, IgG, Rabbit

Sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP

GeneName: ZBTB8B

Ensembl Gene ID: ENSG00000273274

UniProt ID: Q8NAP8

Entrez Gene ID: 728116

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.2

Interspecies Mouse/Rat: ENSRNOG00000026898: 76%, ENSMUSG00000048485: 76%

Enhanced Validation: No

• SKU: ATLHPA071427-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA071427-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 728116
• Host: Rabbit
• Conjugate: Unconjugated