APIP Antibody - N-terminal region : FITC

APIP Antibody - N-terminal region : FITC
SKU
AVIARP56788_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 204

Purification: Affinity Purified
More Information
SKU AVIARP56788_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56788_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51074
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×