APOBEC4 Antibody - N-terminal region : HRP

APOBEC4 Antibody - N-terminal region : HRP
SKU
AVIARP55975_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative C->U-editing enzyme APOBEC-4

Protein Size: 367

Purification: Affinity Purified
More Information
SKU AVIARP55975_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55975_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 403314
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×