ARCN1 Antibody - middle region : Biotin

ARCN1 Antibody - middle region : Biotin
SKU
AVIARP54594_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.This gene maps in a region, which include the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. It is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARCN1

Key Reference: Belanger,B.F., Trends Cell Biol. 16 (10), E1-E4 (2006)

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coatomer subunit delta

Protein Size: 511

Purification: Affinity Purified

Subunit: delta
More Information
SKU AVIARP54594_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54594_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 372
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×