ARFIP2 Antibody - middle region : FITC

ARFIP2 Antibody - middle region : FITC
SKU
AVIARP54459_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arfaptin-2

Protein Size: 256

Purification: Affinity Purified
More Information
SKU AVIARP54459_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54459_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23647
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×