ARFIP2 Antibody - middle region : HRP

ARFIP2 Antibody - middle region : HRP
SKU
AVIARP54459_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arfaptin-2

Protein Size: 256

Purification: Affinity Purified
More Information
SKU AVIARP54459_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54459_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23647
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×