ARHGAP28 Antibody - C-terminal region : Biotin

ARHGAP28 Antibody - C-terminal region : Biotin
SKU
AVIARP53789_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARHGAP28

Key Reference: Nusbaum,C., (2005) Nature 437 (7058), 551-555

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: AKFQYENRILHWQRAALSFLNGKWVKKEREESTETNRSPKHVFLFTIGLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 28

Protein Size: 563

Purification: Affinity Purified
More Information
SKU AVIARP53789_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53789_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79822
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×