ARL8B Antibody - middle region : HRP

ARL8B Antibody - middle region : HRP
SKU
AVIARP57137_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARL8B may play a role in lysosome motility and chromosome segregation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-like protein 8B

Protein Size: 186

Purification: Affinity Purified
More Information
SKU AVIARP57137_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57137_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55207
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×