ARMC3 Antibody - middle region : FITC

ARMC3 Antibody - middle region : FITC
SKU
AVIARP55626_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARMC3

Key Reference: Li,X., (2006) Genetika 42 (7), 999-1003

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 3

Protein Size: 872

Purification: Affinity Purified
More Information
SKU AVIARP55626_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55626_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219681
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×