ARMC8 Antibody - N-terminal region : Biotin

ARMC8 Antibody - N-terminal region : Biotin
SKU
AVIARP56019_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of ARMC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARMC8

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: KVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 8

Protein Size: 659

Purification: Affinity Purified
More Information
SKU AVIARP56019_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56019_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25852
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×