Arsg Antibody - C-terminal region : Biotin

Arsg Antibody - C-terminal region : Biotin
SKU
AVIARP55122_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Arsg displays arylsulfatase activity with pseudosubstrates at acidic pH, such as p-nitrocatechol sulfate.

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: GRDVSEVLFGKSQMGHRVLFHPNSGAAGEYGALQTVRLNHYKAFYITGGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase G

Protein Size: 525

Purification: Affinity Purified
More Information
SKU AVIARP55122_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55122_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 74008
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×