ASPDH Antibody - middle region : Biotin

ASPDH Antibody - middle region : Biotin
SKU
AVIARP56222_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC554235

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative L-aspartate dehydrogenase

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP56222_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56222_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 554235
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×