ASRGL1 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ASGL1

Key Reference: N/A

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: isoaspartyl peptidase/L-asparaginase

Protein Size: 180

Purification: Affinity purified

• SKU: AVIARP53782_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53782_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 80150
• Host: Rabbit
• Conjugate: Conjugated, Biotin