Ataxin 1 Antibody, Clone N76/8: APC

Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
SKU
STRSMC-455D-APC
Packaging Unit
100 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: Ataxin 1

Conjugate: APC

Product Type: Monoclonal

Clone Number: N76/8 (Formerly sold as S76-8)

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Swiss-Prot: P54254

Purification: Protein G Purified

Storage Buffer: 95.64mM Phosphate, 2.48mM MES and 2mM EDTA

Concentration: 1 mg/ml

Specificity: Detects ~85kDa.

Cellular Localization: Cytoplasm / Nucleus

Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
More Information
SKU STRSMC-455D-APC
Manufacturer Stressmarq Biosciences
Manufacturer SKU SMC-455D-APC
Package Unit 100 µg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Monoclonal
Application Immunofluorescence, Immunohistochemistry, Immunocytochemistry
Isotype IgG2b
Human Gene ID 20238
Host Mouse
Conjugate Conjugated, APC (Allophycocyanin)
Product information (PDF) Download
MSDS (PDF) Download