Target: Ataxin 1
Conjugate: ATTO 390
Product Type: Monoclonal
Clone Number: N76/8 (Formerly sold as S76-8)
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Swiss-Prot: P54254
Purification: Protein G Purified
Storage Buffer: 640.91mM DMSO, 136.36mM Ethanolamine, 9.09mM Sodium Bicarbonate in 90.9% PBS
Concentration: 1 mg/ml
Specificity: Detects ~85kDa.
Cellular Localization: Cytoplasm / Nucleus
Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.