Ataxin 1 Antibody, Clone N76/8

Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
SKU
STRSMC-455D
Packaging Unit
100 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Please fill out this
×
to request a sample of this product.
Target: Ataxin 1

Conjugate: Unconjugated

Product Type: Monoclonal

Clone Number: N76/8 (Formerly sold as S76-8)

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Swiss-Prot: P54254

Purification: Protein G Purified

Storage Buffer: PBS pH7.4, 50% glycerol, 0.1% sodium azide *Storage buffer changes when conjugated

Concentration: 1 mg/ml

Specificity: Detects ~85kDa.

Cellular Localization: Cytoplasm / Nucleus

Scientific Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
More Information
SKU STRSMC-455D
Manufacturer Stressmarq Biosciences
Manufacturer SKU SMC-455D
Package Unit 100 µg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Monoclonal
Application Immunofluorescence, Immunoprecipitation, Western Blotting, Immunohistochemistry, Immunocytochemistry
Isotype IgG2b
Human Gene ID 20238
Host Mouse
Conjugate Unconjugated
Product information (PDF) Download
MSDS (PDF) Download