ATP6V1A Antibody - N-terminal region : HRP

ATP6V1A Antibody - N-terminal region : HRP
SKU
AVIARP56324_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP6V1A

Key Reference: Lu,M., (2007) J. Biol. Chem. 282 (34), 24495-24503

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-type proton ATPase catalytic subunit A

Protein Size: 617

Purification: Affinity Purified

Subunit: A
More Information
SKU AVIARP56324_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56324_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 523
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×