ATPAF1 Antibody - N-terminal region : FITC

ATPAF1 Antibody - N-terminal region : FITC
SKU
AVIARP57651_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATPAF1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ATP synthase mitochondrial F1 complex assembly factor 1 Ensembl ENSP00000330685

Protein Size: 260

Purification: Affinity Purified
More Information
SKU AVIARP57651_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57651_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64756
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×