B2M Antibody - N-terminal region : FITC

B2M Antibody - N-terminal region : FITC
SKU
AVIARP56555_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M

Key Reference: Platt,G.W., (2008) J. Mol. Biol. 378 (1), 251-263

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Beta-2-microglobulin

Protein Size: 119

Purification: Affinity Purified
More Information
SKU AVIARP56555_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56555_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 567
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×