BRPF1, His-tag Recombinant

BRPF1, His-tag Recombinant
SKU
BPS31112
Packaging Unit
100 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 2054-2168

Amino Acid Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG

Application: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

Description: Human Bromodomain and PHD finger containing 1, also known as BRPF1, GenBank Accession No. NM_001003694, a.a. 627 - 746 corresponding to single bromodomain with N-terminal His-tag, MW = 15.1 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol

Genbank: NM_013450

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag

Uniprot: P55201

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Laue, K., et al., Development. 2008 June; (135)111: 1935-46.
2. Mayya, V., et al., Sci Signal. 2009 Aug 18; 2(84): ra46
More Information
SKU BPS31112
Manufacturer BPS Bioscience
Manufacturer SKU 31112
Package Unit 100 µg
Quantity Unit STK
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF)
×