BTN3A2 Antibody

Uniprot: P78410

Gene Name: BTN3A2

Immunogen: Recombinant human BTN3A2

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 44%

Core Sequence: FSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADP

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 44%, Rat - 38%, Pig - 50%, Cynomolgus monkey - 96%

Alternative gene names: BT3.2；BTF3；BTF4

Alternative protein names: Butyrophilin subfamily 3 member A2

Protein name: Butyrophilin subfamily 3 member A2

Clone No.: K8U007_7B4

Antigen Species: Human

Target Name: BTN3A2

IHC Verification: succeed

IHC Dilution: 1:200

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PQ-098

Cross reactivity: Not tested

• SKU: ASBKC-2285-50
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-2285-50
• Package Unit: 50 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG1
• Human Gene ID: 11118
• Host: Mouse
• Conjugate: Unconjugated