C10orf132 Antibody - N-terminal region : Biotin

C10orf132 Antibody - N-terminal region : Biotin
SKU
AVIARP54406_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C10orf132 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf132

Key Reference: Deloukas,P., (2004) Nature 429 (6990), 375-381

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Golgin subfamily A member 7B

Protein Size: 167

Purification: Affinity Purified
More Information
SKU AVIARP54406_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54406_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 401647
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×