C11orf67 Antibody - middle region : HRP

C11orf67 Antibody - middle region : HRP
SKU
AVIARP55391_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of C11orf67 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf67

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mth938 domain-containing protein

Protein Size: 122

Purification: Affinity Purified
More Information
SKU AVIARP55391_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55391_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28971
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×