C16orf65 Antibody - middle region : Biotin

C16orf65 Antibody - middle region : Biotin
SKU
AVIARP55697_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ domain-containing protein 9

Protein Size: 202

Purification: Affinity Purified
More Information
SKU AVIARP55697_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55697_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255762
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×