C17orf39 Antibody - C-terminal region : Biotin

C17orf39 Antibody - C-terminal region : Biotin
SKU
AVIARP53762_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39

Key Reference: Bi,W., (2002) Genome Res. 12 (5), 713-728

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose-induced degradation protein 4 homolog

Protein Size: 300

Purification: Affinity Purified
More Information
SKU AVIARP53762_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53762_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79018
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×