C17orf39 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39

Key Reference: Bi,W., (2002) Genome Res. 12 (5), 713-728

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose-induced degradation protein 4 homolog

Protein Size: 300

Purification: Affinity Purified

• SKU: AVIARP53762_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53762_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79018
• Host: Rabbit
• Conjugate: Conjugated, FITC