C17orf48 Antibody - N-terminal region : Biotin

C17orf48 Antibody - N-terminal region : Biotin
SKU
AVIARP57376_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C17orf48

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase

Protein Size: 342

Purification: Affinity Purified
More Information
SKU AVIARP57376_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57376_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56985
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×