C19orf62 Antibody - N-terminal region : Biotin

C19orf62 Antibody - N-terminal region : Biotin
SKU
AVIARP54986_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of C19orf62 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf62

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BRISC and BRCA1-A complex member 1

Protein Size: 329

Purification: Affinity Purified

Subunit: MERIT40
More Information
SKU AVIARP54986_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54986_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29086
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×