C20orf132 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C20orf132

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C20orf132

Protein Size: 573

Purification: Affinity Purified

• SKU: AVIARP53528_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53528_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 140699
• Host: Rabbit
• Conjugate: Conjugated, FITC