C22orf9 Antibody - middle region : HRP

C22orf9 Antibody - middle region : HRP
SKU
AVIARP55213_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of C22orf9 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C22orf9

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein KIAA0930

Protein Size: 409

Purification: Affinity Purified
More Information
SKU AVIARP55213_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55213_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23313
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×