C2orf29 Antibody - N-terminal region : HRP

C2orf29 Antibody - N-terminal region : HRP
SKU
AVIARP56971_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf29

Key Reference: 0

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: UPF0760 protein C2orf29

Protein Size: 510

Purification: Affinity Purified
More Information
SKU AVIARP56971_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56971_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55571
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×