C3 Antibody

Uniprot: P01024

Gene Name: C3

Immunogen: Recombinant human C3

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 86%

Core Sequence: DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 86%, Rat - 90%, Pig - 89%, Cynomolgus monkey - 94%

Alternative gene names: CPAMD1

Alternative protein names: Complement C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1) [Cleaved into: Complement C3 beta chain; C3-beta-c; C3bc; Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein; ASP; C3adesArg; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]

Protein name: Complement C3

Clone No.: K70031_8B8

Antigen Species: Human

Target Name: C3

IHC Verification: -

IHC Dilution: N/A

WB Verification: Fail (Hep G2)

WB Dilution: N/A

IP Verification: Fail (Plasma(SH191-200P))

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-055

Cross reactivity: Not tested

• SKU: ASBKC-2999-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-2999-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG1
• Human Gene ID: 718
• Host: Mouse
• Conjugate: Unconjugated