C4orf20 Antibody - middle region : HRP

C4orf20 Antibody - middle region : HRP
SKU
AVIARP57218_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C4orf20

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ufm1-specific protease 2

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP57218_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57218_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55325
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×