C5orf36 Antibody - N-terminal region : Biotin

C5orf36 Antibody - N-terminal region : Biotin
SKU
AVIARP55682_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of C5orf36 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf36

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein KIAA0825

Protein Size: 324

Purification: Affinity Purified
More Information
SKU AVIARP55682_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55682_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285600
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×