C7orf61 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of LOC402573 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LOC402573

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C7orf61

Protein Size: 206

Purification: Affinity Purified

• SKU: AVIARP54388_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54388_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 402573
• Host: Rabbit
• Conjugate: Conjugated, Biotin