C9orf25 Antibody - middle region : Biotin

C9orf25 Antibody - middle region : Biotin
SKU
AVIARP55478_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein has not been determined.The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus. The function of this protein has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf25

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM219A

Protein Size: 168

Purification: Affinity Purified
More Information
SKU AVIARP55478_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55478_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 203259
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×